Vitronectin is a protein present naturally in animals and can be used with growth media used in cultivated meat to speed up the growth and proliferation of cells. Multus recombinant human Vitronectin can be used as an extracellular matrix (ECM) to promote cell proliferation and supports normal colony morphology for different cell types.
Designed for large-scale industrial usage from the ground up with the production capacity in place.
Our rigorous quality control ensures maximum sterility and minimum endotoxin levels. Risk of contamination from viruses and immunogens are avoided by design.
Produced under ISO22000 food safe manufacturing standard. We are working towards establishing a complete safety profile for using this product in food production. The use of this item is subject to Multus Biotechnology Limited’s Terms and Conditions of Use.
Concentration: 150-250 μg/mL – for exact concentration see the side of the bottle.
The rh-Vitronectin produced by Multus is a truncated version of the wild-type human Vitronectin (VTN-N) fused with a 6-histidine tag with amino acid sequence of:
MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDD
GEEKNNATVHEQVGGPSLTS DLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHP
GRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAA
FTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYF
FKGKQYWEYQFQHQPSQEECEGSSSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISR
DWHGVPGQVDAA MAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSR
HHHHHH
Upon arrival, store the product below -70°C. Upon first thawing, aliquot it to avoid damage via repeated freeze-thaw cycle. Before use, thaw Vitronectin overnight at 4°C, then freeze it immediately after use.
Do you ship internationally?
Yes, we ship to most countries, however we have some limitations as a result of international shipping restrictions, so best to check with us about specific countries.
Are your products 'food safe'?
Multus' growth media formulations and ingredients are produced to certified ISO22000 food safety management standards. Some ingredients (such as growth factors) have not been used as a food ingredient historically, so their safety for human consumption requires separate regulatory approval in each jurisdiction. Multus is prepared to support your application process to demonstrate food-safety.
We are open to exploring ways of working together via collaboration, partnership, investment and media opportunities. Or if you just want to learn more about what we are building, get in touch!